Collagen alpha-1(I) chain

UniProt : P02453, UniProt ID: CO1A1_BOVIN,

Collagen alpha-1(I) chain

Bos taurus

MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQI
CVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQESPTDQETTGVEGPKGDTGPR
GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGISVPGPM
GPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRP
GERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQM
GPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEGGPQGPR
GSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQ
GPSGPPGPKGNSGEPGAPGSKGDTGAKGEPGPTGIQGPPGPAGEEGKRGARGEPGPAGLP
GPPGERGGPGSRGFPGADGVAGPKGPAGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLT
GSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVP
GPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQ
GVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQ
GAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGAPGKDGVRGLTGPIGPPGPAGAPGDK
GEAGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPP
GPAGPAGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPA
GKEGSKGPRGETGPAGRPGEVGPPGPPGPAGEKGAPGADGPAGAPGTPGPQGIAGQRGVV
GLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAE
GSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPIGPV
GARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPR
GPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDAGPAGPPGPPGPPGPPGPPSGGYDLSFL
PQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRD
LKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKEK
RHVWYGESMTGGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQT
GNLKKALLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGAWGKTVIEYKTTKTSRLPIID
VAPLDVGAPDQEFGFDVGPACFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-1(I) chain contains a PF01410 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF00093 domain.

Collagen alpha-1(I) chain is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPQG-IAGQ.

Collagen alpha-1(I) chain is proteolytically cut by matrix metallopeptidase-18 (M10.018) cleavage. GPQG-IAGQ.

Collagen alpha-1(I) chain is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPQG-IAGQ.

Collagen alpha-1(I) chain is proteolytically cut by matrix metallopeptidase-18 (M10.018) cleavage. GPQG-IAGQ.

Collagen alpha-1(I) chain is proteolytically cut by kallikrein hK6 (S01.236) cleavage..