RNA2 polyprotein

UniProt : P03599, UniProt ID: POL2_CPMV,

RNA2 polyprotein

Cowpea mosaic virus

MFSFTEAKSKISLWTRSAAPLNNVYLSYSCRCGLGKRKLAGGCCSAPYITCYDSADFRRV
QYLYFCLTRYCCLYFFLLLLADWFYKKSSIFFETEFSRGFRTWRKIVKLLYILPKFEMES
IMSRGIPSGILEEKAIQFKRAKEGNKPLKDEIPKPEDMYVSHTSKWNVLRKMSQKTVDLS
KAAAGMGFINKHMLTGNILAQPTTVLDIPVTKDKTLAMASDFIRKENLKTSAIHIGAIEI
IIQSFASPESDLMGGFLLVDSLHTDTANAIRSIFVAPMRGGRPVRVVTFPNTLAPVSCDL
NNRFKLICSLPNCDIVQGSQVAEVSVNVAGCATSIEKSHTPSQLYTEEFEKEGAVVVEYL
GRQTYCAQPSNLPTEEKLRSLKFDFHVEQPSVLKLSNSCNAHFVKGESLKYSISGKEAEN
HAVHATVVSREGASAAPKQYDPILGRVLDPRNGNVAFPQMEQNLFALSLDDTSSVRGSLL
DTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNIS
DNSGCCLMLAINSGVRGKYSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMI
SRSRVRMTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGKLT
FPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSWISMWRYFRGELHFEVTKMSSPYIKAT
VTFLIAFGNLSDAFGFYESFPHRIVQFAEVEEKCTLVFSQQEFVTAWSTQVNPRTTLEAD
GCPYLYAIIHDSTTGTISGDFNLGVKLVGIKDFCGIGSNPGIDGSRLLGAIAQGPVCAEA
SDVYSPCMIASTPPAPFSDVTAVTFDLINGKITPVGDDNWNTHIYNPPIMNVLRTAAWKS
GTIHVQLNVRGAGVKRADWDGQVFVYLRQSMNPESYDARTFVISQPGSAMLNFSFDIIGP
NSGFEFAESPWANQTTWYLECVATNPRQIQQFEVNMRFDPNFRVAGNILMPPFPLSTETP
PLLKFRFRDIERSKRSVMVGHTATAA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RNA2 polyprotein contains a PF02247 domain.

RNA2 polyprotein contains a PF02248 domain.

RNA2 polyprotein is proteolytically cut by cowpea mosaic-type comovirus picornain 3C (C03.003) cleavage. AIAQ-GPVC.

RNA2 polyprotein is proteolytically cut by cowpea mosaic-type comovirus picornain 3C (C03.003) cleavage. AFPQ-MEQN.