Strain CBS138 chromosome M complete sequence

UniProt : Q6FJK5, UniProt ID: Q6FJK5_CANGA,

Strain CBS138 chromosome M complete sequence

Candida glabrata

MFQLLTLLLPLVSKVSADCQMIAGNYYCSKTDAAIYSNVGFSGSYQDVTSMDEQSCVCSQ
QPFSFGGALAPFDEELSVHFRGPLKLSQFAVYYPASSNSKRAVAEEDCDSVVAKPVHKHK
RDVAVEVIEVTETVFIDENGNTVTASGTSTSMSTPTPSNPSQVQSSQAPSQAPVSSSNKG
TTTLSSTSKNTPSSSSSFQAASSSAAPIQDGGDWSRVAYFSPGTASGCTFMNHQGGTAGS
GVWSSCFGNSISFANSDGVTGAGSPQPLGDVTIKSGQEYMIFSSTQCSANNAECGYYREG
IPAYKGFGGNRKIFYFEFSMPSDTNGNGYNQDMPAIWLLNAKIPRTLQYGLSTCSCWATG
CGELDLFEVLSPGSDKMITHIHDGQGGGTQDFFQRPTDGIFRAVVIFNASDKTIHLVQVD
SAPAGGLSNDQVQQWLNKAGSAAALP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Strain CBS138 chromosome M complete sequence is proteolytically cut by kexin (S08.070) cleavage. NSKR-AVAE.

Strain CBS138 chromosome M complete sequence is proteolytically cut by kexin (S08.070) cleavage. KHKR-DVAV.