Putative uncharacterized protein

UniProt : Q6FH21, Q92934, UniProt ID: BAD_HUMAN, Q6FH21_HUMAN,

Putative uncharacterized protein

Homo sapiens

MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein is proteolytically cut by () cleavage..

Putative uncharacterized protein is proteolytically cut by () cleavage..

Putative uncharacterized protein is proteolytically cut by () cleavage..