cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha)

UniProt : B2R8L6, P25963, UniProt ID: B2R8L6_HUMAN, IKBA_HUMAN,

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha)

Homo sapiens

MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) contains a PF00023 domain.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) contains a PF00023 domain.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) contains a PF00023 domain.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) contains a PF00023 domain.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) contains a PF00023 domain.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) is proteolytically cut by coxsackievirus-type picornain 3C (C03.011) cleavage. VTYQ-GYSP.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) is proteolytically cut by coxsackievirus-type picornain 3C (C03.011) cleavage. VTYQ-GYSP.

cDNA, FLJ93959, Homo sapiens nuclear factor of kappa light polypeptide geneenhancer in B-cells inhibitor, alpha (NFKBIA), mRNA (Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha) is proteolytically cut by calpain-2 (C02.002) cleavage. KELQ-EIRL.