Homo sapiens

MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSVTS
FKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYS
KLSEGASYLDHTFPAEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIE
DFNSGLIGPLLICKKGTLTEGGTQKTFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNG
TMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTV
GPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVI
WDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILG
PIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET
YTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAA
DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESITTL
GFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGT
WMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEPEDEES
DADYDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALALENGTEFVSSNTDIIVGSNYSSP
SNISKFTVNNLAEPQKAPSHQQATTAGSPLRHLIGKNSVLNSSTAEHSSPYSEDPIEDPL
QPDVTGIRLLSLGAGEFKSQEHAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLSQDTGS
PSGMRPWEDLPSQDTGSPSRMRPWKDPPSDLLLLKQSNSSKILVGRWHLASEKGSYEIIQ
DTDEDTAVNNWLISPQNASRAWGESTPLANKPGKQSGHPKFPRVRHKSLQVRQDGGKSRL
KKSQFLIKTRKKKKEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSLVLHKSNETSLPT
DLNQTLPSMDFGWIASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHS
TSDPSHRSSSPELSEMLEYDRSHKSFPTDISQMSPSSEHEVWQTVISPDLSQVTLSPELS
QTNLSPDLSHTTLSPELIQRNLSPALGQMPISPDLSHTTLSPDLSHTTLSLDLSQTNLSP
ELSQTNLSPALGQMPLSPDLSHTTLSLDFSQTNLSPELSHMTLSPELSQTNLSPALGQMP
ISPDLSHTTLSLDFSQTNLSPELSQTNLSPALGQMPLSPDPSHTTLSLDLSQTNLSPELS
QTNLSPDLSEMPLFADLSQIPLTPDLDQMTLSPDLGETDLSPNFGQMSLSPDLSQVTLSP
DISDTTLLPDLSQISPPPDLDQIFYPSESSQSLLLQEFNESFPYPDLGQMPSPSSPTLND
TFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINS
SRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVVF
RKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKS
SEGKTYEDDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPGSACRAWAYYSAVNPEKDI
HSGLIGPLLICQKGILHKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMK
KSHEFHAINGMIYSLPGLKMYEQEWVRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLG
VWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRAGMQTPFLIMDRDCRMPMGLSTGIISD
SQIKASEFLGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWIQVDMQKEVIITGIQTQG
AKHYLKSCYTTEFYVAYSSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQFDPPIVARY
IRISPTRAYNRPTLRLELQGCEVNGCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFR
ARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQ
GVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSIALRLELFG
CDIY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. MATR-KMHD.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. LIQR-NLSP.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. LSPR-TFHP.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. LGIR-SFRN.

is proteolytically cut by plasmin (S01.233) cleavage..

is proteolytically cut by thrombin (S01.217) cleavage. WYLR-SNNG.

is proteolytically cut by thrombin (S01.217) cleavage. LSPR-TFHP.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by protein C (S01.218) cleavage. RLKK-SQFL.

is proteolytically cut by protein C (S01.218) cleavage. LDRR-GIQR.

is proteolytically cut by protein C (S01.218) cleavage. KKTR-NLKK.

is proteolytically cut by protein C (S01.218) cleavage. MATR-KMHD.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. WRLT-SSEM.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. RRGI-QRAA.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. VIPA-NMDK.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. PLVI-VGLS.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. VTGI-RLLS.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by thrombin (S01.217) cleavage. WYLR-SNNG.

is proteolytically cut by thrombin (S01.217) cleavage. LSPR-TFHP.

is proteolytically cut by factor V activator (S01.184) cleavage. WYLR-SNNG.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. SSWR-LTSS.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. WYLR-SNNG.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. LSPR-TFHP.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. LGIR-SFRN.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. MATR-KMHD.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. LIQR-NLSP.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. LSPR-TFHP.

is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. LGIR-SFRN.

is proteolytically cut by plasmin (S01.233) cleavage..

is proteolytically cut by thrombin (S01.217) cleavage. WYLR-SNNG.

is proteolytically cut by thrombin (S01.217) cleavage. LSPR-TFHP.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by protein C (S01.218) cleavage. RLKK-SQFL.

is proteolytically cut by protein C (S01.218) cleavage. LDRR-GIQR.

is proteolytically cut by protein C (S01.218) cleavage. KKTR-NLKK.

is proteolytically cut by protein C (S01.218) cleavage. MATR-KMHD.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. WRLT-SSEM.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. RRGI-QRAA.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. VIPA-NMDK.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. PLVI-VGLS.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. VTGI-RLLS.

is proteolytically cut by thrombin (S01.217) cleavage. LGIR-SFRN.

is proteolytically cut by thrombin (S01.217) cleavage. WYLR-SNNG.

is proteolytically cut by thrombin (S01.217) cleavage. LSPR-TFHP.

is proteolytically cut by factor V activator (S01.184) cleavage. WYLR-SNNG.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. SSWR-LTSS.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. WYLR-SNNG.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. LSPR-TFHP.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage. LGIR-SFRN.

is proteolytically cut by EspC peptidase (S06.010) cleavage..

is proteolytically cut by Pet peptidase (S06.004) cleavage..

is proteolytically cut by EspP g.p. (S06.002) cleavage..

is proteolytically cut by Sat peptidase (S06.004) cleavage..

is proteolytically cut by Tsh peptidase (S06.003) cleavage..

is proteolytically cut by Pic peptidase (S06.005) cleavage..