KLK14

UniProt : A7UNK5, Q9P0G3, UniProt ID: A7UNK5_HUMAN, KLK14_HUMAN,

KLK14

Homo sapiens

MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQ
WVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQP
ARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYP
RTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKY
RSWIEETMRDK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLK14 contains a PF00089 domain.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TCTR-SSQP.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. AGPR-RRFL.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. YNSR-THDN.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. RIGR-AVRP.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. TSCR-VSGW.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PIAR-YPAS.

KLK14 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. AYPR-TITP.