Secretory aspartyl proteinase SAP3p

UniProt : P43092, Q5ANA2, UniProt ID: CARP3_CANAL, Q5ANA2_CANAL,

Secretory aspartyl proteinase SAP3p

Candida albicans

MFLKNIFIALAIALLADATPTTFNNSPGFVALNFDVIKTHKNVTGPQGEINTNVNVKRQT
VPVKLINEQVSYASDITVGSNKQKLTVVIDTGSSDLWVPDSQVSCQAGQGQDPNFCKNEG
TYSPSSSSSSQNLNSPFSIEYGDGTTSQGTWYKDTIGFGGISITKQQFADVTSTSVDQGI
LGIGYKTHEAEGNYDNVPVTLKNQGIISKNAYSLYLNSRQATSGQIIFGGVDNAKYSGTL
IALPVTSDNELRIHLNTVKVAGQSINADVDVLLDSGTTITYLQQGVADQVISAFNGQETY
DANGNLFYLVDCNLSGSVDFAFDKNAKISVPASEFTAPLYTEDGQVYDQCQLLFGTSDYN
ILGDNFLRSAYIVYDLDDNEISLAQVKYTTASNIAALT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Secretory aspartyl proteinase SAP3p contains a PF00026 domain.

Secretory aspartyl proteinase SAP3p is proteolytically cut by kexin (S08.070) cleavage. NVKR-QTVP.