Furin-like prohormone convertase

UniProt : Q16962, UniProt ID: Q16962_APLCA,

Furin-like prohormone convertase

Aplysia californica

MFLALVLGSVVGAEVYLNQFAVHISGGHSAASRVARDTGFINLGQIGSLDDHYLFEIPHR
QRRSATHSHEHHTALTDHGEVGWFEQQVVKSRSKRDFHPRDVAEQMSVLDPYWKNQWYLH
GGAQGGYDMKVMEAWREGYTGKNIVVAILDDGLEHNHPDLIKNYDPYASYDLNDHDNDPM
PRYDASNENRHGTRCAGEVSAEANNTACTIGIAPDSRIGGIRMLDGEVYDAVEAASLSFN
RSHVDIYSASWGPDDDGKVVDGPGKLAKEAFIKGIENGRGGKGSIFVWASGNGGSAHDSC
NCDGYANSIFTLSISSTSENGIKPWYLEECSSTLASTYSSGAYNERQIATTDLRQRCTTT
HTGTSASAPLAAGIVALVLEANRDLTWRDVQYITLMTSRSDPIEDGQWIVNGVGRKVSLR
YGYGLMDATEMVKLAKVWRQVPEKHECLITSDVQNVPLASGNKFSSQVLTNGCVGTSTEV
NYLEHVQARISLTHSQRGSVVIYLTSPSGTRSKVLPARSNDVAPGGFDNWPLLSVHFWGE
NPRGTWTLEIEEANMYNRRSSGGKLASWSLVLHGTRVKPVRLLNETSPATTTKTTAATTS
STSTTTTKKPSTPKVEACHKECAGGCTGTRPEDCNECKNFRVSSTRVCVSQCPDGFYTSG
DMCMPCDASCATCSGPALTECQSCHEGRHYHQLKDKHSVCNIECVDGFFYSTNSCLPCDV
GCKHCESSALHCTACRKGYSLKDDKCVSQAAVVSVMFEHITLSIVLISVIVLLVVFIFMG
LLYMYRNQLFFWSDRKMYGPVPREDEEAVVRLTYSDDFDEDFKS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Furin-like prohormone convertase contains a PF00082 domain.

Furin-like prohormone convertase contains a PF00757 domain.

Furin-like prohormone convertase contains a PF01483 domain.

Furin-like prohormone convertase is proteolytically cut by furin (S08.071) cleavage. RSKR-DFHP.