Mitochondrial inner membrane protein OXA1

UniProt : P39952, UniProt ID: OXA1_YEAST,

Mitochondrial inner membrane protein OXA1

Saccharomyces cerevisiae

MFKLTSRLVTSRFAASSRLATARTIVLPRPHPSWISFQAKRFNSTGPNANDVSEIQTQLP
SIDELTSSAPSLSASTSDLIANTTQTVGELSSHIGYLNSIGLAQTWYWPSDIIQHVLEAV
HVYSGLPWWGTIAATTILIRCLMFPLYVKSSDTVARNSHIKPELDALNNKLMSTTDLQQG
QLVAMQRKKLLSSHGIKNRWLAAPMLQIPIALGFFNALRHMANYPVDGFANQGVAWFTDL
TQADPYLGLQVITAAVFISFTRLGGETGAQQFSSPMKRLFTILPIISIPATMNLSSAVVL
YFAFNGAFSVLQTMILRNKWVRSKLKITEVAKPRTPIAGASPTENMGIFQSLKHNIQKAR
DQAERRQLMQDNEKKLQESFKEKRQNSKIKIVHKSNFINNKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mitochondrial inner membrane protein OXA1 contains a PF02096 domain.

Mitochondrial inner membrane protein OXA1 is proteolytically cut by Oma1 peptidase (M48.018) cleavage. TRLG-GETG.