Homo sapiens

MFIMGLGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELES
LARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCN
NRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGG
SQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by furin (S08.071) cleavage. RGRR-SLGS.

is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. RGRR-SLGS.

is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. RGRR-SLGS.

is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RGRR-SLGS.

is proteolytically cut by furin (S08.071) cleavage. RPVT-RSPG.

is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. RPVT-RSPG.

is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. RPVT-RSPG.

is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RPVT-RSPG.