Brain-derived neurotrophic factor BDNF1
|
UniProt : Q6YNR3, UniProt ID: Q6YNR3_HUMAN, Brain-derived neurotrophic factor BDNF1 Homo sapiens MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAG SRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEE YKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPV SKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIR IDTSCVCTLTIKRGR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Brain-derived neurotrophic factor BDNF1 contains a PF00243 domain.
Brain-derived neurotrophic factor BDNF1 is proteolytically cut by plasmin (S01.233) cleavage. MSMR-VRRH.