Induced myeloid leukemia cell differentiation protein Mcl-1

UniProt : Q07820, UniProt ID: MCL1_HUMAN,

Induced myeloid leukemia cell differentiation protein Mcl-1

Homo sapiens

MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Induced myeloid leukemia cell differentiation protein Mcl-1 contains a PF00452 domain.

Induced myeloid leukemia cell differentiation protein Mcl-1 is proteolytically cut by caspase-3 (C14.003) cleavage. EELD-GYEP.

Induced myeloid leukemia cell differentiation protein Mcl-1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage..

Induced myeloid leukemia cell differentiation protein Mcl-1 is proteolytically cut by caspase-3 (C14.003) cleavage. TSTD-GSLP.