Attacin-E

UniProt : P01513, UniProt ID: ATTE_HYACE,

Attacin-E

Hyalophora cecropia

MFGKIVFLLLVALCAGVQSRYLIVSEPVYYIEHYEEPELLASSRVRRDAHGALTLNSDGT
SGAVVKVPFAGNDKNIVSAIGSVDLTDRQKLGAATAGVALDNINGHGLSLTDTHIPGFGD
KMTAAGKVNVFHNDNHDITAKAFATRNMPDIANVPNFNTVGGGIDYMFKDKIGASASAAH
TDFINRNDYSLDGKLNLFKTPDTSIDFNAGFKKFDTPFMKSSWEPNFGFSLSKYF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Attacin-E contains a PF03768 domain.

Attacin-E contains a PF03769 domain.

Attacin-E is proteolytically cut by inhA g.p. (M06.001) cleavage..