Ligatin

UniProt : Q61211, UniProt ID: LIGA_MOUSE,

Ligatin

Mus musculus

MFAKAFRVKSNTAIKGSDRRKLRADVTAAFPALGTDQISELIPGKEELNVVKLYVHKGDS
VTVYTSGGNPILFELEKNLYPTVYTLWAYPDILPTFITWPLVLEKLVGGADLMLPGVVVP
PTGLPQVQQGDLCAIALVGNRAPVAIGVAAMSTAQMLASGLKGKGVSVLHTYQDHLWRSG
DKSSPPAIAPLDPTDSCEEKVHLGLQGNLKSLTLDGEEENGQVPLREASEDTSSRAPSQD
SLDGKPLQEQMDDLLLRCFLHALKSRVKKADLPLLTSTLLGSHMFSCCPEGQQLDIKKSS
YKKLSKFLQHMQQEQIVQVKELSKGVESIVAVDWRHPRITSFVIPEPSLTSQTVQEVSRE
QPYLPPDIKSLYCVPANMTQLFLESGHKKGSTLEGSEVRKIITDYAKRNRLVDADNRNLV
KLDPILCDCILEKNEQHLVTKLPWDCLLTRCLKNMQPAYQVTFPGQEPILKKGKLCPIDI
TLALKTYNKKVTVVRNLETYGLDPCSVAAILQQRCQASTIVSPAPGAKDSLQVQVQGNQI
HHLGQLLLEEYRLPGKYIQGLEKAPKPGKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ligatin contains a PF01253 domain.

Ligatin is proteolytically cut by caspase-1 (C14.001) cleavage. DSLD-GKPL.