Isoform DFF35 of DNA fragmentation factor subunit alpha

UniProt : O00273, Q5T6G5, UniProt ID: O00273-2, Q5T6G5_HUMAN,

Isoform DFF35 of DNA fragmentation factor subunit alpha

Homo sapiens

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT
LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA
GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD
QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH
ILTALREKQAPELSLSSQDLEVGGNQGH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform DFF35 of DNA fragmentation factor subunit alpha contains a PF09033 domain.

Isoform DFF35 of DNA fragmentation factor subunit alpha contains a PF02017 domain.

Isoform DFF35 of DNA fragmentation factor subunit alpha is proteolytically cut by caspase-3 (C14.003) cleavage. DETD-SGAG.

Isoform DFF35 of DNA fragmentation factor subunit alpha is proteolytically cut by caspase-3 (C14.003) cleavage. DAVD-TGIS.