DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA)

UniProt : O00273, Q5T6G6, UniProt ID: DFFA_HUMAN, Q5T6G6_HUMAN,

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA)

Homo sapiens

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT
LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA
GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD
QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH
ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT
QSLHSLRSISASKASPPGDLQNPKRARQDPT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) contains a PF09033 domain.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) contains a PF02017 domain.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VTGD-AGVP.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VTGD-AGVP.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DAVD-TGIS.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DETD-SGAG.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. DAVD-TGIS.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. DETD-SGAG.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DETD-SGAG.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. DAVD-TGIS.

DNAation factor, 45kDa, alpha polypeptide (DNAation factor, 45kDa, alpha polypeptide, isoform CRA_c) (cDNA, FLJ93833, Homo sapiens DNAation factor, 45kDa, alpha polypeptide(DFFA), mRNA) is proteolytically cut by caspase-7 (C14.004) cleavage..