Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease)

UniProt : B1AKD7, UniProt ID: B1AKD7_HUMAN,

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease)

Homo sapiens

MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) contains a PF00104 domain.

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) contains a PF00105 domain.

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) contains a PF02166 domain.

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) is proteolytically cut by caspase-1 (C14.001) cleavage..

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) is proteolytically cut by caspase-3 (C14.003) cleavage..

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) is proteolytically cut by caspase-7 (C14.004) cleavage..

Androgen receptor (Dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease) is proteolytically cut by caspase-8 (C14.009) cleavage..