Heterogeneous nuclear ribonucleoprotein A3

UniProt : P51991, UniProt ID: ROA3_HUMAN,

Heterogeneous nuclear ribonucleoprotein A3

Homo sapiens

MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Heterogeneous nuclear ribonucleoprotein A3 contains a PF00076 domain.

Heterogeneous nuclear ribonucleoprotein A3 contains a PF00076 domain.

Heterogeneous nuclear ribonucleoprotein A3 is proteolytically cut by caspase () cleavage. SRED-SVKP.

Heterogeneous nuclear ribonucleoprotein A3 is proteolytically cut by caspase () cleavage. DDHD-TVDK.

Heterogeneous nuclear ribonucleoprotein A3 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IKED-TEEY.