cDNA, FLJ96240, Homo sapiens serine/threonine kinase 4 (STK4), mRNA (Serine/threonine kinase 4, isoform CRA_a)

UniProt : B2RCR8, Q13043, UniProt ID: B2RCR8_HUMAN, STK4_HUMAN,

cDNA, FLJ96240, Homo sapiens serine/threonine kinase 4 (STK4), mRNA (Serine/threonine kinase 4, isoform CRA_a)

Homo sapiens

METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96240, Homo sapiens serine/threonine kinase 4 (STK4), mRNA (Serine/threonine kinase 4, isoform CRA_a) contains a PF00069 domain.

cDNA, FLJ96240, Homo sapiens serine/threonine kinase 4 (STK4), mRNA (Serine/threonine kinase 4, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. TMTD-GANT.

cDNA, FLJ96240, Homo sapiens serine/threonine kinase 4 (STK4), mRNA (Serine/threonine kinase 4, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DEMD-SGTM.

cDNA, FLJ96240, Homo sapiens serine/threonine kinase 4 (STK4), mRNA (Serine/threonine kinase 4, isoform CRA_a) is proteolytically cut by caspase () cleavage. TMTD-GANT.