Nudix (Nucleoside diphosphate linked moiety X)-type motif 5

UniProt : A2ATT6, Q9JKX6, UniProt ID: A2ATT6_MOUSE, NUDT5_MOUSE,

Nudix (Nucleoside diphosphate linked moiety X)-type motif 5

Mus musculus

METRESTESSPGKHLVTSEELISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSADA
VSVIPVLQRTLHHECVILVKQFRPPMGSYCLEFPAGFIEDGESPEAAALRELEEETGYKG
EVAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPGDGEFMEVISLPKNDLLTR
LDALGAEQHLTVDAKVYAYGLALKHANSKPFEVPFLKF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Nudix (Nucleoside diphosphate linked moiety X)-type motif 5 contains a PF00293 domain.

Nudix (Nucleoside diphosphate linked moiety X)-type motif 5 is proteolytically cut by caspase-1 (C14.001) cleavage. YCLE-FPAG.