Beta-crystallin A3

UniProt : P14881, UniProt ID: CRBA1_RAT,

Beta-crystallin A3

Rattus norvegicus

METQTVQRELETLPTTKMAQTNPMPGSMGPWKITIYDQENFQGKRMEFTSSCPNVSERSF
DNVRSLKVECGAWIGYEHTSFCGQQFILERGEYPRWDAWSGSNAYHIERLMSFRPICSAN
HKESKITIFEKENFIGRQWEICDDYPSLQAMGWFNNEVGSMKIQCGAWVCYQYPGYRGYQ
YILECDHHGGDYKHWREWGTHAQTSQIQSIRRIQQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-crystallin A3 contains a PF00030 domain.

Beta-crystallin A3 contains a PF00030 domain.

Beta-crystallin A3 is proteolytically cut by calpain-2 (C02.002) cleavage. RELE-TLPT.