Proepiregulin
|
UniProt : Q61521, UniProt ID: EREG_MOUSE, Proepiregulin Mus musculus METLPASWVLTLLCLGSHLLQAVISTTVIPSCIPGESEDNCTALVQMEDDPRVAQVQITK CSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFLTVHQPLSKEYVALTVILIF LFLIITAGCIYYFCRWYKNRKSKKSREEYERVTSGDPVLPQV The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Proepiregulin contains a PF00008 domain.
Proepiregulin is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..