cDNA, FLJ96714, Homo sapiens second mitochondria-derived activator of caspase(SMAC), nuclear gene encoding mitochondrial protein, transcriptvariant 1, mRNA

UniProt : B2RDQ0, Q9NR28, UniProt ID: B2RDQ0_HUMAN, DBLOH_HUMAN,

cDNA, FLJ96714, Homo sapiens second mitochondria-derived activator of caspase(SMAC), nuclear gene encoding mitochondrial protein, transcriptvariant 1, mRNA

Homo sapiens

MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA
QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL
LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS
ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96714, Homo sapiens second mitochondria-derived activator of caspase(SMAC), nuclear gene encoding mitochondrial protein, transcriptvariant 1, mRNA contains a PF09057 domain.

cDNA, FLJ96714, Homo sapiens second mitochondria-derived activator of caspase(SMAC), nuclear gene encoding mitochondrial protein, transcriptvariant 1, mRNA is proteolytically cut by calpain-2 (C02.002) cleavage..