Heterogeneous nuclear ribonucleoprotein K

UniProt : P61978, UniProt ID: HNRPK_HUMAN,

Heterogeneous nuclear ribonucleoprotein K

Homo sapiens

METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Heterogeneous nuclear ribonucleoprotein K contains a PF00013 domain.

Heterogeneous nuclear ribonucleoprotein K contains a PF00013 domain.

Heterogeneous nuclear ribonucleoprotein K contains a PF00013 domain.

Heterogeneous nuclear ribonucleoprotein K contains a PF08067 domain.

Heterogeneous nuclear ribonucleoprotein K is proteolytically cut by caspase () cleavage. SGYD-YSYA.

Heterogeneous nuclear ribonucleoprotein K is proteolytically cut by granzyme B, human-type (S01.010) cleavage. PAED-MEEE.

Heterogeneous nuclear ribonucleoprotein K is proteolytically cut by granzyme B, human-type (S01.010) cleavage. SYGD-LGGP.