TatA

UniProt : A1YH68, UniProt ID: A1YH68_PROST,

TatA

Providencia stuartii

MESTIATAAFGSPWQLIIIALLIILIFGTKKLRSLGSDLGESLKGFKKAMNDDEAAKAAK
EEQEKQDADFAPKNITEQQQAADKKDSPVESKNKEQG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

TatA contains a PF02416 domain.

TatA is proteolytically cut by aarA protein (S54.004) cleavage. IATA-AFGS.