Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)

UniProt : Q05823, Q5W0L2, UniProt ID: Q5W0L2_HUMAN, RN5A_HUMAN,

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)

Homo sapiens

MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGW
TPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNE
CDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGH
VEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGK
TPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD
CGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGK
LKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCG
YTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFE
DLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVG
NESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVG
DLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTH
SPNKPQCDGAGGASGLASPGC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF06479 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00069 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) contains a PF00023 domain.

Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) is proteolytically cut by neutrophil elastase (S01.131) cleavage..