MAP2K3 protein (cDNA, FLJ96569, Homo sapiens mitogen-activated protein kinase kinase 3 (MAP2K3),transcript variant B, mRNA) (Mitogen-activated protein kinase kinase 3 isoform B)

UniProt : P46734, Q6FI23, UniProt ID: MP2K3_HUMAN, Q6FI23_HUMAN,

MAP2K3 protein (cDNA, FLJ96569, Homo sapiens mitogen-activated protein kinase kinase 3 (MAP2K3),transcript variant B, mRNA) (Mitogen-activated protein kinase kinase 3 isoform B)

Homo sapiens

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

MAP2K3 protein (cDNA, FLJ96569, Homo sapiens mitogen-activated protein kinase kinase 3 (MAP2K3),transcript variant B, mRNA) (Mitogen-activated protein kinase kinase 3 isoform B) contains a PF00069 domain.

MAP2K3 protein (cDNA, FLJ96569, Homo sapiens mitogen-activated protein kinase kinase 3 (MAP2K3),transcript variant B, mRNA) (Mitogen-activated protein kinase kinase 3 isoform B) is proteolytically cut by anthrax lethal factor (M34.001) cleavage. KDLR-ISCM.