Calcium modulating ligand (Calcium modulating ligand, isoform CRA_a) (cDNA, FLJ93649, Homo sapiens calcium modulating ligand (CAMLG), mRNA)

UniProt : A1L3Y3, P49069, UniProt ID: A1L3Y3_HUMAN, CAMLG_HUMAN,

Calcium modulating ligand (Calcium modulating ligand, isoform CRA_a) (cDNA, FLJ93649, Homo sapiens calcium modulating ligand (CAMLG), mRNA)

Homo sapiens

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEE
SQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKP
PECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGN
TTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKT
TVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Calcium modulating ligand (Calcium modulating ligand, isoform CRA_a) (cDNA, FLJ93649, Homo sapiens calcium modulating ligand (CAMLG), mRNA) is proteolytically cut by caspase () cleavage. VATD-GGER.

Calcium modulating ligand (Calcium modulating ligand, isoform CRA_a) (cDNA, FLJ93649, Homo sapiens calcium modulating ligand (CAMLG), mRNA) is proteolytically cut by caspase () cleavage. DKLD-SFIK.