Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3)

UniProt : A7LFZ5, UniProt ID: A7LFZ5_HUMAN,

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3)

Homo sapiens

MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRT
FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW
FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM
IRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEI
DMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQ
QQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLETVRNDLKTEGK
K

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) contains a PF02809 domain.

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) contains a PF02809 domain.

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) contains a PF02809 domain.

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) contains a PF02099 domain.

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) is proteolytically cut by caspase-3 (C14.003) cleavage..

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) is proteolytically cut by caspase-3 (C14.003) cleavage..

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) is proteolytically cut by caspase-1 (C14.001) cleavage. QEID-MEDE.

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) is proteolytically cut by caspase-1 (C14.001) cleavage. DMED-EEAD.

Ataxin 3 (Ataxin 3, isoform CRA_b) (Putative uncharacterized protein ATXN3) is proteolytically cut by caspase-1 (C14.001) cleavage. EEAD-LRRA.