cDNA, FLJ96446, Homo sapiens glial fibrillary acidic protein (GFAP), mRNA (Glial fibrillary acidic protein, isoform CRA_d)

UniProt : B2RD44, P14136, UniProt ID: B2RD44_HUMAN, GFAP_HUMAN,

cDNA, FLJ96446, Homo sapiens glial fibrillary acidic protein (GFAP), mRNA (Glial fibrillary acidic protein, isoform CRA_d)

Homo sapiens

MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96446, Homo sapiens glial fibrillary acidic protein (GFAP), mRNA (Glial fibrillary acidic protein, isoform CRA_d) contains a PF04732 domain.

cDNA, FLJ96446, Homo sapiens glial fibrillary acidic protein (GFAP), mRNA (Glial fibrillary acidic protein, isoform CRA_d) contains a PF00038 domain.

cDNA, FLJ96446, Homo sapiens glial fibrillary acidic protein (GFAP), mRNA (Glial fibrillary acidic protein, isoform CRA_d) is proteolytically cut by caspase-3 (C14.003) cleavage. DLTD-AAAR.