cDNA, FLJ96242, highly similar to Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mRNA (General transcription factor IIF, polypeptide 1, 74kDa, isoform CRA_a)

UniProt : B2RCS0, P35269, UniProt ID: B2RCS0_HUMAN, T2FA_HUMAN,

cDNA, FLJ96242, highly similar to Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mRNA (General transcription factor IIF, polypeptide 1, 74kDa, isoform CRA_a)

Homo sapiens

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG
VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSA
LFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96242, highly similar to Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mRNA (General transcription factor IIF, polypeptide 1, 74kDa, isoform CRA_a) contains a PF05793 domain.

cDNA, FLJ96242, highly similar to Homo sapiens general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mRNA (General transcription factor IIF, polypeptide 1, 74kDa, isoform CRA_a) is proteolytically cut by caspase () cleavage. QEVD-YMSD.