Alpha-1-antichymotrypsin

UniProt : P01011, UniProt ID: AACT_HUMAN,

Alpha-1-antichymotrypsin

Homo sapiens

MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSL
YKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQ
HLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVM
VPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWR
DSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
KQA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha-1-antichymotrypsin contains a PF00079 domain.

Alpha-1-antichymotrypsin is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ITLL-SALV.

Alpha-1-antichymotrypsin is proteolytically cut by serralysin (M10.051) cleavage. TLLS-ALVE.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by aureolysin (M04.009) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by clostripain (C11.001) cleavage. NQDR-GTHV.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by kallikrein hK2 (S01.161) cleavage. ITLL-SALV.

Alpha-1-antichymotrypsin is proteolytically cut by serralysin (M10.051) cleavage. TLLS-ALVE.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by aureolysin (M04.009) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by pseudolysin (M04.005) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by clostripain (C11.001) cleavage. NQDR-GTHV.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LLSA-LVET.

Alpha-1-antichymotrypsin is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. LTQE-NQDR.

Alpha-1-antichymotrypsin is proteolytically cut by trypsin 1 (S01.151) cleavage. NQDR-GTHV.

Alpha-1-antichymotrypsin is proteolytically cut by neutrophil elastase (S01.131) cleavage. VKIT-LLSA.