Isoform 2 of DNA-repair protein XRCC4

UniProt : Q13426, UniProt ID: Q13426-2,

Isoform 2 of DNA-repair protein XRCC4

Homo sapiens

MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQ
TDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKEKPD
SSLPETSKKEHISAENMSLETLRNSSPEDLFDEI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of DNA-repair protein XRCC4 contains a PF06632 domain.

Isoform 2 of DNA-repair protein XRCC4 is proteolytically cut by caspase-3 (C14.003) cleavage. DVTD-IAPS.

Isoform 2 of DNA-repair protein XRCC4 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VSKD-DSII.