CD14 antigen (Monocyte differentiation antigen CD14)

UniProt : P08571, Q53XT5, UniProt ID: CD14_HUMAN, Q53XT5_HUMAN,

CD14 antigen (Monocyte differentiation antigen CD14)

Homo sapiens

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CD14 antigen (Monocyte differentiation antigen CD14) contains a PF00560 domain.

CD14 antigen (Monocyte differentiation antigen CD14) contains a PF00560 domain.

CD14 antigen (Monocyte differentiation antigen CD14) contains a PF00560 domain.

CD14 antigen (Monocyte differentiation antigen CD14) is proteolytically cut by gingipain R (C25.001) cleavage..

CD14 antigen (Monocyte differentiation antigen CD14) is proteolytically cut by gingipain R (C25.001) cleavage..