Proprotein convertase subtilisin/kexin type 1

UniProt : P63239, Q32MU0, UniProt ID: NEC1_MOUSE, Q32MU0_MOUSE,

Proprotein convertase subtilisin/kexin type 1

Mus musculus

MEQRGWTLQCTAFAFFCVWCALNSVKAKRQFVNEWAAEIPGGQEAASAIAEELGYDLLGQ
IGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQYEKERSKRSVQKDSALDL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECVVKDNNFEPRALK
ANGEVIVEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLKITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVNVVEKRPTQKSLNGNLLVPKNSSSSNVEGRRDEQVQ
GTPSKAMLRLLQSAFSKNALSKQSPKKSPSAKLSIPYESFYEALEKLNKPSKLEGSEDSL
YSDYVDVFYNTKPYKHRDDRLLQALMDILNEEN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proprotein convertase subtilisin/kexin type 1 contains a PF00082 domain.

Proprotein convertase subtilisin/kexin type 1 contains a PF01483 domain.

Proprotein convertase subtilisin/kexin type 1 is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RSKR-SVQK.