cDNA FLJ77336, highly similar to Homo sapiens serine/threonine kinase 3 (STE20 homolog, yeast) (STK3), mRNA (Serine/threonine kinase 3) (STE20 homolog, yeast)

UniProt : A8K722, Q13188, UniProt ID: A8K722_HUMAN, STK3_HUMAN,

cDNA FLJ77336, highly similar to Homo sapiens serine/threonine kinase 3 (STE20 homolog, yeast) (STK3), mRNA (Serine/threonine kinase 3) (STE20 homolog, yeast)

Homo sapiens

MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77336, highly similar to Homo sapiens serine/threonine kinase 3 (STE20 homolog, yeast) (STK3), mRNA (Serine/threonine kinase 3) (STE20 homolog, yeast) contains a PF00069 domain.

cDNA FLJ77336, highly similar to Homo sapiens serine/threonine kinase 3 (STE20 homolog, yeast) (STK3), mRNA (Serine/threonine kinase 3) (STE20 homolog, yeast) is proteolytically cut by caspase-3 (C14.003) cleavage. DELD-SHTM.