Transforming protein RhoA

UniProt : P61586, UniProt ID: RHOA_HUMAN,

Transforming protein RhoA

Homo sapiens

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Transforming protein RhoA contains a PF00071 domain.

Transforming protein RhoA is proteolytically cut by Ulp1 peptidase (C48.001) cleavage. KKSG-CLVL.

Transforming protein RhoA is proteolytically cut by YopT peptidase (C58.001) cleavage. KKSG-CLVL.

Transforming protein RhoA is proteolytically cut by Ulp1 peptidase (C48.001) cleavage. KKSG-CLVL.

Transforming protein RhoA is proteolytically cut by YopT peptidase (C58.001) cleavage. KKSG-CLVL.

Transforming protein RhoA is proteolytically cut by calpain-1 (C02.001) cleavage. TKDG-VREV.

Transforming protein RhoA is proteolytically cut by Ulp1 peptidase (C48.001) cleavage. KKSG-CLVL.

Transforming protein RhoA is proteolytically cut by YopT peptidase (C58.001) cleavage. KKSG-CLVL.

Transforming protein RhoA is proteolytically cut by calpain-1 (C02.001) cleavage. TKDG-VREV.

Transforming protein RhoA is proteolytically cut by YopT peptidase (C58.001) cleavage. KKSG-CLVL.