Leukocyte elastase inhibitor

UniProt : P30740, UniProt ID: ILEU_HUMAN,

Leukocyte elastase inhibitor

Homo sapiens

MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF
NTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVD
FQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEAT
TNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDES
TGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLF
FIRHNSSGSILFLGRFSSP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Leukocyte elastase inhibitor contains a PF00079 domain.

Leukocyte elastase inhibitor is proteolytically cut by chymase (S01.140) cleavage. IATF-CMLM.

Leukocyte elastase inhibitor is proteolytically cut by pancreatic elastase (S01.153) cleavage. ATFC-MLMP.

Leukocyte elastase inhibitor is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ATFC-MLMP.

Leukocyte elastase inhibitor is proteolytically cut by cathepsin G (S01.133) cleavage. IATF-CMLM.

Leukocyte elastase inhibitor is proteolytically cut by chymotrypsin B (S01.152) cleavage. IATF-CMLM.

Leukocyte elastase inhibitor is proteolytically cut by proteinase-3 (S01.134) cleavage. ATFC-MLMP.

Leukocyte elastase inhibitor is proteolytically cut by neutrophil elastase (S01.131) cleavage. ATFC-MLMP.