Endothelin-3
|
UniProt : P14138, UniProt ID: EDN3_HUMAN, Endothelin-3 Homo sapiens MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAG PGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINT PEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVS SNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Endothelin-3 contains a PF00322 domain.
Endothelin-3 is proteolytically cut by chymase (S01.140) cleavage. TVPY-GLSN.
Endothelin-3 is proteolytically cut by Kell blood-group protein (M13.090) cleavage. DIIW-INTP.
Endothelin-3 is proteolytically cut by chymase (S01.140) cleavage. TVPY-GLSN.
Endothelin-3 is proteolytically cut by Kell blood-group protein (M13.090) cleavage. DIIW-INTP.
Endothelin-3 is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. DIIW-INTP.