Collagenase 3 (Fragment)

UniProt : P23097, UniProt ID: MMP13_RAT,

Collagenase 3 (Fragment)

Rattus norvegicus

ATFFLLSWTHCWSLPLPYGDDDDDDLSEEDLEFAEHYLKSYYHPVTLAGILKKSTVTSTV
DRLREMQSFFGLDVTGKLDDPTLDIMRKPRCGVPDVGVYNVFPRTLKWSQTNLTYRIVNY
TPDISHSEVEKAFRKAFKVWSDVTPLNFTRIHDGTADIMISFGTKEHGDFYPFDGPSGLL
AHAFPPGPNLGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYT
YTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGETMIFKD
RFFWRLHPQQVEPELFLTKSFWPELPNHVDAAYEHPSRDLMFIFRGRKFWALNGYDIMEG
YPRKISDLGFPKEVKRLSAAVHFEDTGKTLFFSGNHVWSYDDANQTMDKDYPRLIEEEFP
GIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSLLWC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagenase 3 (Fragment) contains a PF00045 domain.

Collagenase 3 (Fragment) contains a PF00045 domain.

Collagenase 3 (Fragment) contains a PF00045 domain.

Collagenase 3 (Fragment) contains a PF00045 domain.

Collagenase 3 (Fragment) contains a PF00413 domain.

Collagenase 3 (Fragment) contains a PF01471 domain.

Collagenase 3 (Fragment) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DVGV-YNVF.