cDNA, FLJ92495, Homo sapiens polymerase (RNA) II (DNA directed) polypeptide I,14.5kDa (POLR2I), mRNA

UniProt : B2R5J2, P36954, UniProt ID: B2R5J2_HUMAN, RPB9_HUMAN,

cDNA, FLJ92495, Homo sapiens polymerase (RNA) II (DNA directed) polypeptide I,14.5kDa (POLR2I), mRNA

Homo sapiens

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92495, Homo sapiens polymerase (RNA) II (DNA directed) polypeptide I,14.5kDa (POLR2I), mRNA contains a PF02150 domain.

cDNA, FLJ92495, Homo sapiens polymerase (RNA) II (DNA directed) polypeptide I,14.5kDa (POLR2I), mRNA is proteolytically cut by caspase () cleavage. MEPD-GTYE.