DNA-directed RNA polymerase II subunit RPB9

UniProt : P60898, UniProt ID: RPB9_MOUSE,

DNA-directed RNA polymerase II subunit RPB9

Mus musculus

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DNA-directed RNA polymerase II subunit RPB9 contains a PF02150 domain.

DNA-directed RNA polymerase II subunit RPB9 is proteolytically cut by caspase-1 (C14.001) cleavage. PDGT-YEPG.