Isoform PML-X of Probable transcription factor PML

UniProt : P29590, UniProt ID: P29590-5,

Isoform PML-X of Probable transcription factor PML

Homo sapiens

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNESGFSWGYPHPFLI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform PML-X of Probable transcription factor PML contains a PF00643 domain.

Isoform PML-X of Probable transcription factor PML contains a PF00643 domain.

Isoform PML-X of Probable transcription factor PML contains a PF00097 domain.

Isoform PML-X of Probable transcription factor PML is proteolytically cut by caspase-3 (C14.003) cleavage. PHLD-GPPS.

Isoform PML-X of Probable transcription factor PML is proteolytically cut by caspase-3 (C14.003) cleavage. PHLD-GPPS.

Isoform PML-X of Probable transcription factor PML is proteolytically cut by neutrophil elastase (S01.131) cleavage. PMAV-VQSV .

Isoform PML-X of Probable transcription factor PML is proteolytically cut by neutrophil elastase (S01.131) cleavage. PVPV-YAFS.