cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a)
|
UniProt : A8K5M2, P42574, UniProt ID: A8K5M2_HUMAN, CASP3_HUMAN, cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) Homo sapiens MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) contains a PF00656 domain.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-11 (C14.012) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-15 (C14.038) cleavage..
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-11 (C14.012) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-15 (C14.038) cleavage..
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-4 (C14.007) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-4 (C14.007) cleavage. NSVD-SKSI.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-8 (C14.009) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-10 (C14.011) cleavage. NSVD-SKSI.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-11 (C14.012) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-15 (C14.038) cleavage..
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-4 (C14.007) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-4 (C14.007) cleavage. NSVD-SKSI.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-8 (C14.009) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-10 (C14.011) cleavage. NSVD-SKSI.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IETD-SGVD.
cDNA FLJ75691, highly similar to Homo sapiens caspase 3, apoptosis-related cysteine protease(CASP3), transcript variant alpha, mRNA (Caspase 3, apoptosis-related cysteine peptidase, isoform CRA_a) is proteolytically cut by myeloblastin (S01.134) cleavage..