PMAP: SubstrateDB : cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA

cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA

UniProt : B2R6T4, P39687, UniProt ID: AN32A_HUMAN, B2R6T4_HUMAN,

cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA

Homo sapiens

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA contains a PF00560 domain.

cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. GEVD-DEED.

cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. NDGE-VDDE.