cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA
UniProt : B2R6T4, P39687, UniProt ID: AN32A_HUMAN, B2R6T4_HUMAN, cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA Homo sapiens MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE PEDEGEDDD The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA contains a PF00560 domain.
cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA contains a PF00560 domain.
cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. GEVD-DEED.
cDNA, FLJ93102, Homo sapiens acidic (leucine-rich) nuclear phosphoprotein 32family, member A (ANP32A), mRNA is proteolytically cut by granzyme B, human-type (S01.010) cleavage. NDGE-VDDE.