Exportin 5

UniProt : A2RRJ5, Q924C1, UniProt ID: A2RRJ5_MOUSE, XPO5_MOUSE,

Exportin 5

Mus musculus

MEMEQVNALCEELVKAVTVMMDPSSTQRYRLEALKFCEEFKEKCPICVPCGLKLAEKTQI
AIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMELIANGTLRILEEENHIKDVLSRIV
VEMIKREWPQHWPDMLMELDTLFRQGETQRELVMFILLRLAEDVVTFQTLPTQRRRDIQQ
TLTQNMERILNFLLNTLQENVNKYQQMKTDSSQEAEAQANCRVSVAALNTLAGYIDWVSL
NHITAENCKLVETLCLLLNEQELQLGAAECLLIAVSRKGKLEDRKRLMILFGDVAMHYIL
SAAQTADGGGLVEKHYLFLKRLCQVLCALGNLLCALLALDANIQTPINFGMYLESFLAFT
THPSQFLRSSTHMTWGALFRHEVLSRDPALLAVIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQHGEVVRCVCRLDPKTSFQMAAEWLKYQLSASIDTGPVN
SCSTAGTGEGGFCSIFSPSYVQWEAMTFFLESVINQMFRTLDKEELPVSDGIELLQLVLN
FEIKDPLVLSCVLTNVSALFPFVTYKPAFLPQVFSKLFSFVTFESVGESKAPRTRAVRNV
RRHACSSINKMCRDYPDLVLPNFDMLYSHVKQLLSNELLLTQMEKCALMEALVLVSNQFK
DYERQKLFLEELMAPVVNIWLSEEMCRALSDIDSFIAYVGADLKSCDPAVEDPCGLNRAR
MSFCVYSILGVMRRTSWPSDLEEAKAGGFVVGYTPSGNPIFRNPCTEQILRLLDNLLALV
RTHNTLYTPEMLTKMAEPFTKALDIVESEKTAILGLPQPLLEFNDHPVYRTTLERMQRFF
GILYENCYHILGKAGPSMQQDFYTVEDLASQLLGSAFVNLNNIPDFRLRSMLRVFVKPLV
LFCPSEHYETLISPILGPLFTYLHMRLSQKWHVINQRSILCGEDEIAEDNPESQEMLEEQ
LVRMLTREAMDLIMACCVSKKTADHTAAPTADGDDEEMMATEVAPSSVVELTDLGKCLMK
HEDVCTALLITAFNSLTWKDTLSCQRATTQLCWPLLKQVMSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDCKLLNPSLQK
AADKRRKDHFKRLIAGCIGKPLGEQFRKEVHIKNLPWLFKKPKPMLETEVLDSEEGGLAT
IFEP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Exportin 5 contains a PF08389 domain.

Exportin 5 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. CGED-EIAE.