DNAation factor, alpha subunit

UniProt : B2KFX0, O54786, UniProt ID: B2KFX0_MOUSE, DFFA_MOUSE,

DNAation factor, alpha subunit

Mus musculus

MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPIT
LVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWTYNDSDGGTAWVSQESFEADEPDSRA
GVKWKNVARQLKEDLSSIILLSEEDLQALIDIPCAELAQELCQSCATVQGLQSTLQQVLD
QREEARQSKQLLELYLQALEKEGNILSNQKESKAALSEELDAVDTGVGREMASEVLLRSQ
ILTTLKEKPAPELSLSSQDLESVSKEDPKALAVALSWDIRKAETVQQACTTELALRLQQV
QSLHSLRNLSARRSPLPGEPQRPKRAKRDSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DNAation factor, alpha subunit contains a PF02017 domain.

DNAation factor, alpha subunit contains a PF09033 domain.

DNAation factor, alpha subunit is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VSQE-SFEA.