Putative uncharacterized protein

UniProt : Q8BQC7, UniProt ID: Q8BQC7_MOUSE,

Putative uncharacterized protein

Mus musculus

MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPIT
LVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWIYNDSDGGTAWVSQESFEADEPDSRA
GVKWKNVARQLKEDLSSIILLSEEDLQALIDIPCAELAQELCQSCATVQGLQSTLQQVLD
QREEARQSKQLLELYLQALEKEGNILSNQKESKAALSEELDAVDTGVGREMASEVLLRSQ
ILTTLKEKPAPELSLSSQDLESVSKEDPKALAVALSWDIRKAETVQQACTTELALRLQQV
QSLHSLRNLSARRSPLPGEPQRPKRAKRDSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF02017 domain.

Putative uncharacterized protein contains a PF09033 domain.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. DEPD-SRAG.

Putative uncharacterized protein is proteolytically cut by caspase-3 (C14.003) cleavage. DAVD-TGVG .