Eukaryotic peptide chain release factor GTP-binding subunit ERF3A

UniProt : P15170, UniProt ID: ERF3A_HUMAN,

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A

Homo sapiens

MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKP
KSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRET
WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV
LVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK
LVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGE
NLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLR
DEGKTIAIGKVLKLVPEKD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A contains a PF00009 domain.

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A contains a PF03143 domain.

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A contains a PF03144 domain.

Eukaryotic peptide chain release factor GTP-binding subunit ERF3A is proteolytically cut by caspase () cleavage. SLGD-GRPP.